RPB9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88179

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RPB9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPB9. Peptide sequence: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RPB9 Antibody - BSA Free

Western Blot: RPB9 Antibody [NBP2-88179]

Western Blot: RPB9 Antibody [NBP2-88179]

Western Blot: RPB9 Antibody [NBP2-88179] - WB Suggested Anti-POLR2I Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Placenta

Applications for RPB9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPB9

RPB9 encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with two other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA. The product of this gene has two zinc finger motifs with conserved cysteines and the subunit does possess zinc binding activity. [provided by RefSeq]

Alternate Names

DNA-directed RNA polymerase II 14.5 kDa polypeptide, DNA-directed RNA polymerase II subunit I, DNA-directed RNA polymerase II subunit RPB9, hRPB14.5, polymerase (RNA) II (DNA directed) polypeptide I (14.5kD), polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa, RNA polymerase II 14.5 kDa subunit, RNA polymerase II subunit B9, RPB14.5, RPB9

Gene Symbol

POLR2I

Additional RPB9 Products

Product Documents for RPB9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPB9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPB9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPB9 Antibody - BSA Free and earn rewards!

Have you used RPB9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies