RPL13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13250

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RPL13 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL13 Antibody - BSA Free

Western Blot: RPL13 Antibody [NBP2-13250]

Western Blot: RPL13 Antibody [NBP2-13250]

Western Blot: RPL13 Antibody [NBP2-13250] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: RPL13 Antibody [NBP2-13250]

Immunohistochemistry-Paraffin: RPL13 Antibody [NBP2-13250]

Immunohistochemistry-Paraffin: RPL13 Antibody [NBP2-13250] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
RPL13 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: RPL13 Antibody - BSA Free [NBP2-13250]

Immunocytochemistry/ Immunofluorescence: RPL13 Antibody - BSA Free [NBP2-13250]

Staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum.
RPL13 Antibody - BSA Free Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
RPL13 Antibody - BSA Free Western Blot: RPL13 Antibody - BSA Free [NBP2-13250]

Western Blot: RPL13 Antibody - BSA Free [NBP2-13250]

Analysis in human cell line NB4.
RPL13 Antibody - BSA Free Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
RPL13 Antibody - BSA Free Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
RPL13 Antibody - BSA Free Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Immunohistochemistry: RPL13 Antibody - BSA Free [NBP2-13250]

Staining of human lymph node shows strong cytoplasmic positivity in subset of non-germinal center cells.

Applications for RPL13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL13

RPL13, also known as 60S ribosomal protein L13, is a 24kDa 211 amino acid protein with a shorter 19kDA 164 isoform produced by alternative splicing. RPL13 belongs to the L13E family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on RPL13 in relation to Smith-Magenis syndrome, Treacher Collins syndrome, breast carcinoma, carcinoma, skin atrophy, prostate cancer, prostatitis, schizophrenia and malaria. RPL13 has been linked to the reverse transcription, ribosome assembly, cell division, DNA protection and pigmentation pathways where it interacts with RPL4, RPL8, RPS3, SMN1 and RPL12.

Alternate Names

BBC1FLJ27454, Breast basic conserved protein 1, D16S444E, FLJ27453, MGC117342, MGC71373,60S ribosomal protein L13, OK/SW-cl.46, ribosomal protein L13

Gene Symbol

RPL13

Additional RPL13 Products

Product Documents for RPL13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RPL13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL13 Antibody - BSA Free and earn rewards!

Have you used RPL13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies