RPS3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55339

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS3A Antibody - BSA Free

Western Blot: RPS3A Antibody [NBP2-55339]

Western Blot: RPS3A Antibody [NBP2-55339]

Western Blot: RPS3A Antibody [NBP2-55339] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RPS3A Antibody [NBP2-55339]

Immunocytochemistry/ Immunofluorescence: RPS3A Antibody [NBP2-55339]

Immunocytochemistry/Immunofluorescence: RPS3A Antibody [NBP2-55339] - Staining of human cell line MCF7 shows localization to nucleoli, cytosol & endoplasmic reticulum.
Western Blot: RPS3A Antibody [NBP2-55339]

Western Blot: RPS3A Antibody [NBP2-55339]

Western Blot: RPS3A Antibody [NBP2-55339] - Analysis using Anti-RPS3A antibody NBP2-55339 (A) shows similar pattern to independent antibody NBP2-13264 (B).

Applications for RPS3A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS3A

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Alternate Names

40S ribosomal protein S3a, FTE1, fte-1, MFTL, MGC23240, ribosomal protein S3A, v-fos transformation effector protein, v-fos transformation effector protein 1

Gene Symbol

RPS3A

Additional RPS3A Products

Product Documents for RPS3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS3A Antibody - BSA Free and earn rewards!

Have you used RPS3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...