RRAD Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58864

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RRAD Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RRAD(Ras-related associated with diabetes) The peptide sequence was selected from the middle region of RRAD. Peptide sequence LARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RRAD Antibody - BSA Free

Western Blot: RRAD Antibody [NBP1-58864]

Western Blot: RRAD Antibody [NBP1-58864]

Western Blot: RRAD Antibody [NBP1-58864] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: RRAD Antibody [NBP1-58864]

Western Blot: RRAD Antibody [NBP1-58864]

Western Blot: RRAD Antibody [NBP1-58864] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for RRAD Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RRAD

RRAD may play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca2+ currents. RRAD regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. RRAD inhibits cardiac hy

Alternate Names

RAD1, RADGTP-binding protein RAD, RAS (RAD and GEM) like GTP binding 3, Ras associated with diabetes, Ras-related associated with diabetes, REM3

Gene Symbol

RRAD

UniProt

P55042 (Human)

Additional RRAD Products

Product Documents for RRAD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RRAD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRAD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRAD Antibody - BSA Free and earn rewards!

Have you used RRAD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies