RRP7A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88193

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RRP7A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RRP7A. Peptide sequence: KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RRP7A Antibody - BSA Free

Western Blot: RRP7A Antibody [NBP2-88193]

Western Blot: RRP7A Antibody [NBP2-88193]

Western Blot: RRP7A Antibody [NBP2-88193] - Host: Rabbit. Target Name: Rrp7a. Sample Type: Rat Spleen lysates. Antibody Dilution: 1.0ug/ml

Applications for RRP7A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RRP7A

The RRP7A gene encodes a 280 amino acid, 32 kDA ribosomal RNA-processing protein 7 homolog A that has been linked to gastric cancer. The RRP7A gene participates in the ribosome biogenesis in eukaryotes and has been known to interact with genes UBC, SIRT7, MAPK6, and GABARAP.

Alternate Names

BK126B4.3, CGI-96, CTA-126B4.5, Gastric cancer antigen Zg14, MGC150422, MGC150423, ribosomal RNA processing 7 homolog A (S. cerevisiae), ribosomal RNA-processing protein 7 homolog A

Gene Symbol

RRP7A

Additional RRP7A Products

Product Documents for RRP7A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RRP7A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRP7A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRP7A Antibody - BSA Free and earn rewards!

Have you used RRP7A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies