S100A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38959

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for S100A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Analysis in human esophagus and liver tissues. Corresponding S100A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human esophagus shows strong positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human stomach shows low expression as expected.
Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959]

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in a subset of cells in tubules.

Applications for S100A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100A2

S100 alpha 2 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.

Long Name

S100 Calcium Binding Protein A2

Alternate Names

CAN19, S100L

Gene Symbol

S100A2

UniProt

Additional S100A2 Products

Product Documents for S100A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S100A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100A2 Antibody - BSA Free and earn rewards!

Have you used S100A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...