S100A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54679

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to S100A3(S100 calcium binding protein A3) The peptide sequence was selected from the N terminal of S100A3. Peptide sequence MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for S100A3 Antibody - BSA Free

Western Blot: S100A3 Antibody [NBP1-54679]

Western Blot: S100A3 Antibody [NBP1-54679]

Western Blot: S100A3 Antibody [NBP1-54679] - OVCAR-3 cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: S100A3 Antibody [NBP1-54679]

Immunohistochemistry-Paraffin: S100A3 Antibody [NBP1-54679]

Immunohistochemistry-Paraffin: S100A3 Antibody [NBP1-54679] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

Applications for S100A3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S100A3

S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

Alternate Names

Protein S-100E, S100 calcium binding protein A3, S100 calcium-binding protein A3S100Eprotein S100-A3

Gene Symbol

S100A3

UniProt

Additional S100A3 Products

Product Documents for S100A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S100A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S100A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S100A3 Antibody - BSA Free and earn rewards!

Have you used S100A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...