S1P2/EDG-5/S1PR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09441

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all S1P2/EDG-5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human S1P2/EDG-5/S1PR2 (NP_004221). Peptide sequence MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for S1P2/EDG-5/S1PR2 Antibody - BSA Free

Western Blot: S1P2/EDG-5/S1PR2 Antibody [NBP3-09441]

Western Blot: S1P2/EDG-5/S1PR2 Antibody [NBP3-09441]

Western Blot: S1P2/EDG-5/S1PR2 Antibody [NBP3-09441] - Western blot analysis of S1P2/EDG-5/S1PR2 in COLO205 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for S1P2/EDG-5/S1PR2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: S1P2/EDG-5

This EDG5 protein is a member of the G protein-coupled receptors, as well as the EDG family of proteins. This protein participates in sphingosine 1-phosphate-induced cell proliferation, survival, and transcriptional activation.

Long Name

Endothelial Differentiation Gene 5

Alternate Names

AGR16, EDG5, GPCR13, GPCR18, H218, LPB2, S1PR2

Gene Symbol

S1PR2

Additional S1P2/EDG-5 Products

Product Documents for S1P2/EDG-5/S1PR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for S1P2/EDG-5/S1PR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for S1P2/EDG-5/S1PR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review S1P2/EDG-5/S1PR2 Antibody - BSA Free and earn rewards!

Have you used S1P2/EDG-5/S1PR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies