SALM4/LRFN3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91348

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human LRFN3. Peptide sequence VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SALM4/LRFN3 Antibody - BSA Free

Western Blot: SALM4/LRFN3 Antibody [NBP1-91348]

Western Blot: SALM4/LRFN3 Antibody [NBP1-91348]

Western Blot: SALM4/LRFN3 Antibody [NBP1-91348] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for SALM4/LRFN3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SALM4/LRFN3

Synaptic adhesion-like molecule 4 (SALM4; also leucine-rich repeat and fibronectin type-III domain-containing protein 3 (Lrfn3) is an approximately 90 kDa member of the Lrfn family of type I transmembrane glycoproteins. Human SALM4 is synthesized as a 628 amino acid (aa) precursor that contains a 16 aa signal sequence, a 523 aa extracellular domain (ECD), a 21 aa transmembrane region, and a 68 aa cytoplasmic region. The ECD consists of six leucine-rich repeats (LRR), an IgC2-like domain, and a fibronectin type-III domain, tandemly aligned in that order. In addition, there are five potential sites for N-linked glycosylation. SALM4 and SALM5 lack a C-terminal intracellular PDZ binding domain, which is conserved among SALMs 1-3. Mature human SALM4 shares 96% aa sequence identity with mature mouse SALM4. Northern blot analysis showed that in mice, SALM4 is strongly expressed in the adult brain and is also present in the adult gastrointestinal tract and kidneys. It is distributed throughout the neuron, including the growth cone. In the developing mouse embryo, a temporal expression profile blot revealed a general increment of expression around E10.5, with weak expression detected before E10.5. SALM4, like the other SALMs, promotes neurite outgrowth. Specifically, the SALMs modify total outgrowth and neurite branching.

Long Name

Leucine-rich Repeat and Fibronectin Type III Domain Containing Protein 3

Alternate Names

FIGLER1, LRFN3

Gene Symbol

LRFN3

UniProt

Additional SALM4/LRFN3 Products

Product Documents for SALM4/LRFN3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SALM4/LRFN3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SALM4/LRFN3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SALM4/LRFN3 Antibody - BSA Free and earn rewards!

Have you used SALM4/LRFN3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...