Synaptic adhesion-like molecule 4 (SALM4; also leucine-rich repeat and fibronectin type-III domain-containing protein 3 (Lrfn3) is an approximately 90 kDa member of the Lrfn family of type I transmembrane glycoproteins. Human SALM4 is synthesized as a 628 amino acid (aa) precursor that contains a 16 aa signal sequence, a 523 aa extracellular domain (ECD), a 21 aa transmembrane region, and a 68 aa cytoplasmic region. The ECD consists of six leucine-rich repeats (LRR), an IgC2-like domain, and a fibronectin type-III domain, tandemly aligned in that order. In addition, there are five potential sites for N-linked glycosylation. SALM4 and SALM5 lack a C-terminal intracellular PDZ binding domain, which is conserved among SALMs 1-3. Mature human SALM4 shares 96% aa sequence identity with mature mouse SALM4. Northern blot analysis showed that in mice, SALM4 is strongly expressed in the adult brain and is also present in the adult gastrointestinal tract and kidneys. It is distributed throughout the neuron, including the growth cone. In the developing mouse embryo, a temporal expression profile blot revealed a general increment of expression around E10.5, with weak expression detected before E10.5. SALM4, like the other SALMs, promotes neurite outgrowth. Specifically, the SALMs modify total outgrowth and neurite branching.
SALM4/LRFN3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91348
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the C terminal of human LRFN3. Peptide sequence VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for SALM4/LRFN3 Antibody - BSA Free
Western Blot: SALM4/LRFN3 Antibody [NBP1-91348]
Western Blot: SALM4/LRFN3 Antibody [NBP1-91348] - HepG2 cell lysate, concentration 0.2-1 ug/ml.Applications for SALM4/LRFN3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SALM4/LRFN3
Long Name
Leucine-rich Repeat and Fibronectin Type III Domain Containing Protein 3
Alternate Names
FIGLER1, LRFN3
Gene Symbol
LRFN3
UniProt
Additional SALM4/LRFN3 Products
Product Documents for SALM4/LRFN3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SALM4/LRFN3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for SALM4/LRFN3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SALM4/LRFN3 Antibody - BSA Free and earn rewards!
Have you used SALM4/LRFN3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...