Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein

Novus Biologicals | Catalog # NBP2-90986

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

His (N-Term), Avi-tag

Applications

ELISA, SDS-PAGE
View all SARS-CoV-2 Envelope Proteins and Enzymes »

Product Specifications

Description

A full length recombinant protein with a N-Terminal His-tag and Avi epitope tag and corresponding to the amino acids sequence of (1-75) of the SARS-CoV-2 envelope protein

Source: E.coli


MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV (Accession #YP_009724392.1)

Purity

>95%, by SDS-PAGE

Endotoxin Level

< 0.1 EU/ug of the protein by LAL method.

Predicted Molecular Mass

11.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Application Notes

Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Envelope at 2ug/mL (100 uL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images

ELISA: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986]

ELISA: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986]

ELISA: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986] - Immobilized Recombinant SARS-CoV-2 Envelope at 2ug/mL (100 uL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.
SDS-PAGE: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986]

SDS-PAGE: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986]

SDS-Page: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986] - Recombinant SARS-CoV-2 Envelope Protein with His and Avi tag was determined by SDS-PAGE with Coomassie Blue, showing a band at 12 kDa.

Formulation, Preparation, and Storage

NBP2-90986
Formulation Supplied as a 0.22 um filtered solution in 20mM Tris, 250mM NaCl, 0.5%TritonX-100, pH 8.0.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20 to -70C. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 Envelope

The SARS-CoV-2 Envelope protein is one of the four major structural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). The envelope protein is the smallest of the four structural proteins, which also includes the membrane protein, spike protein, and nucleocapsid protein (1,2). The envelope protein is synthesized as a 75 amino acid protein with a theoretical molecular weight of approximately 8.4 kDa (2,3). Furthermore, the envelope protein of SARS-CoV-2 has 94.7% sequence identity and 97.4% sequence similarity to the envelope protein of SARS-CoV (2). Structurally, the envelope protein is a membrane protein with a N-terminal domain, an alpha-helical transmembrane domain, and a hydrophilic C-terminal domain (1,4). The envelope protein has multiple functions in viral replication including viral assembly, release, and pathogenesis (2,4). Additionally, the SARS-CoV-2 envelope protein has ion channel activity and functions as a viroporin with a role in virion trafficking (2,4). Coronaviruses lacking the envelope protein are shown to have reduced viral titer and slowed or defective maturation, indicative of a role in virus production and growth (4).

References

1. Malik Y. A. (2020). Properties of Coronavirus and SARS-CoV-2. The Malaysian Journal of Pathology.

2. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

3. Uniprot (P0DTC4)

4. J Alsaadi, E. A., & Jones, I. M. (2019). Membrane binding proteins of coronaviruses. Future Virology. https://doi.org/10.2217/fvl-2018-0144

Alternate Names

2019-nCoV Envelope protein, COVID-19 Envelope protein, E Protein, Envelope, Human Coronavirus Envelope protein, SARSCoV2, SARS-CoV-2 E protein, SARSCoV2 Envelope protein, SARS-CoV-2 Envelope protein, Severe acute respiratory syndrome 2 Envelope Protein

Gene Symbol

E

Additional SARS-CoV-2 Envelope Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein

Customer Reviews

There are currently no reviews for this product. Be the first to review Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein and earn rewards!

Have you used Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes