SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15990

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

SARS-CoV-2

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1). SWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASAN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 nsp2 AntibodyAzide and BSA Free [NBP3-15990]

Western Blot: SARS-CoV-2 nsp2 AntibodyAzide and BSA Free [NBP3-15990]

Western Blot: SARS-CoV-2 nsp2 Antibody [NBP3-15990] - Western blot analysis of extracts of normal 293T cells and 293T transfected with NSP2 Protein, using SARS-CoV-2 nsp2 antibody (NBP3-15990) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Applications for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:2000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 nsp2

SARS-CoV-2 Nonstructural Protein 2 (NSP2) is one of the sixteen nonstructural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 NSP2 is 638 amino acids (aa) with a theoretical molecular weight of 70.5 kDa (1,2). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's NSP2 has 68.3% sequence identity and 90% sequence similarity (1). SARS-CoV-2 NSP2 is shown to bind two host proteins, prohibitin 1 (PHB1) and prohibitin 2 (PHB2) (1). The NSP2-PHB protein interaction indicates that SARS-CoV-2 NBP2 might function in disturbing the host-cell environment during viral infection (1). A SARS-CoV-2 interactome study revealed that NSP2 has a role in vesicle trafficking, specifically reconfiguring endoplasmic reticulum and Golgi trafficking during viral infection via the WASH complex (Wiskott Aldrich Syndrome protein and scar homologue complex) (2).

References

1. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

2. Gordon, D. E., Jang, G. M., Bouhaddou, M., Xu, J., Obernier, K., White, K. M., O'Meara, M. J., Rezelj, V. V., Guo, J. Z., Swaney, D. L., Tummino, T. A., Huttenhain, R., Kaake, R. M., Richards, A. L., Tutuncuoglu, B., Foussard, H., Batra, J., Haas, K., Modak, M., Kim, M.,... Krogan, N. J. (2020). A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature. https://doi.org/10.1038/s41586-020-2286-9

Alternate Names

Non-structural protein 2, NSP2, p65 homolog

Gene Symbol

ORF1ab

Additional SARS-CoV-2 nsp2 Products

Product Documents for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SARS-CoV-2 nsp2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SARS-CoV-2 nsp2 Antibody - Azide and BSA Free and earn rewards!

Have you used SARS-CoV-2 nsp2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...