SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16001

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

SARS-CoV-2

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

Western Blot: SARS-CoV-2 ORF6 AntibodyAzide and BSA Free [NBP3-16001]

Western Blot: SARS-CoV-2 ORF6 AntibodyAzide and BSA Free [NBP3-16001]

Western Blot: SARS-CoV-2 ORF6 Antibody [NBP3-16001] - Western blot analysis of extracts of 293T cells, using SARS-CoV-2 ORF6 antibody (NBP3-16001) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SARS-CoV-2 ORF6

SARS-CoV-2 Open Reading Frame 6 (ORF6) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF6 is 61 amino acids (aa) with a theoretical molecular weight of 7.2 kDa (2, 3). The amino acid sequence alignment of SARS-CoV and SARS-CoV-2's ORF7a has 68.9% sequence identity and 93.4% sequence similarity (3).

SARS-CoV-2 ORF6 is an ER/Golgi membrane protein that disrupts the formation of the nuclear import complex by binding karyopherin alpha 2 (KPNA2) and karyopherin beta 1 (KPNB1) (2, 4). More specifically, it was found that this disruption is mediated by ORF6's localization to the nuclear pore complex (NPC) where it binds Nup98-Rae1 to target the nuclear import pathway (5). This disruption further prevents the transport of signal transducer and activator of transcription 1 (STAT1) and ultimately blocks interferon (IFN) production and antiviral responses (2, 4, 5). It has been hypothesized that the pathology of COVID-19 is largely initiated by the SARS-CoV-2 proteins ORF6 and non-structural protein 1 (NSP1) which together inhibit STAT1 activity (4). The repression of STAT1 thereby instead promotes STAT3 activation and the upregulation of plasminogen activator inhibitor-1 (PAI-1), leading to a cascade of events that are key features of COVID-19 (4). These harmful events include thrombosis, production of cytokines and chemokines by macrophages, profibrotic changes, hypoxia, and eventual T-cell lymphopenia (4). These finding suggest that targeting STAT1 and STAT3 might be beneficial therapeutic strategies for treating COVID-19.

References

1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1

2. UniProt (P0DTC6)

3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4

4. Matsuyama, T., Kubli, S. P., Yoshinaga, S. K., Pfeffer, K., & Mak, T. W. (2020). An aberrant STAT pathway is central to COVID-19. Cell death and differentiation, 1-17. Advance online publication. https://doi.org/10.1038/s41418-020-00633-7

5. Miorin, L., Kehrer, T., Sanchez-Aparicio, M. T., Zhang, K., Cohen, P., Patel, R. S., Cupic, A., Makio, T., Mei, M., Moreno, E., Danziger, O., White, K. M., Rathnasinghe, R., Uccellini, M., Gao, S., Aydillo, T., Mena, I., Yin, X., Martin-Sancho, L., Krogan, N. J.,... Garcia-Sastre, A. (2020). SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling. Proceedings of the National Academy of Sciences of the United States of America, 202016650. Advance online publication. https://doi.org/10.1073/pnas.2016650117

Alternate Names

2019-nCoV ORF6, 2019-nCoV ORF6 Protein, Accessory Protein 6, COVID-19 Non-structural protein 6, COVID-19 ns6, COVID-19 ORF6, COVID-19 Protein X3, Human coronavirus ORF6 Protein, Non-structural protein 6, NS6, ORF6 protein, SARS-CoV-2, SARS-CoV-2 Accessory Protein 6, SARS-CoV-2 Non-structural protein 6, SARS-CoV-2 ns6, SARSCoV2 ORF6 Protein, SARS-CoV-2 ORF6 Protein, SARS-CoV-2 Protein X3, Severe Acute Respiratory Syndrome Coronavirus 2

Gene Symbol

ORF6

Additional SARS-CoV-2 ORF6 Products

Product Documents for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SARS-CoV-2 ORF6 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SARS-CoV-2 ORF6 Antibody - Azide and BSA Free and earn rewards!

Have you used SARS-CoV-2 ORF6 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...