SCAF8/RBM16 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15752

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SCAF8/RBM16 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 572-634 of human SCAF8/RBM16 (NP_055707.3). PWEKVKVDDLEGFAEGGMIDQETVNTEWETVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCAF8/RBM16 Antibody - Azide and BSA Free

SCAF8/RBM16 Antibody - Azide and BSA Free

Western Blot: SCAF8/RBM16 Antibody - Azide and BSA Free [NBP3-15752] -

Western Blot: SCAF8/RBM16 Antibody - Azide and BSA Free [NBP3-15752] - Western blot analysis of extracts of HeLa cells, using SCAF8/RBM16 antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
SCAF8/RBM16 Antibody - Azide and BSA Free

Western Blot: SCAF8/RBM16 Antibody - Azide and BSA Free [NBP3-15752] -

Western Blot: SCAF8/RBM16 Antibody - Azide and BSA Free [NBP3-15752] - Western blot analysis of extracts of various cell lines, using SCAF8/RBM16 antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for SCAF8/RBM16 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SCAF8/RBM16

SCAF8/RBM16 (SR-related and CTD-associated factor 8) contains an RNA recognition motif found in a variety of RNA binding proteins that function in RNA processing. The function of SCAF8 is unknown.

Alternate Names

CCAP7, CDC5L complex-associated protein 7, KIAA1116RNA-binding protein 16, putative RNA-binding protein 16, RBM16, RNA binding motif protein 16, RNA-binding motif protein 16, SR-like CTD-associated factor 8, SR-related and CTD-associated factor 8, SR-related CTD-associated factor 8

Gene Symbol

SCAF8

Additional SCAF8/RBM16 Products

Product Documents for SCAF8/RBM16 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SCAF8/RBM16 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCAF8/RBM16 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SCAF8/RBM16 Antibody - Azide and BSA Free and earn rewards!

Have you used SCAF8/RBM16 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies