SCARA3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13286
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LNNCSFCHEAGQLGPEIRKLQEELEGIQKLLLAQEVQLDQTLQAQEVLSTTSRQISQEMGSCSFSIHQVNQSLGLFLAQVRGWQATTAGLDLSLKDLTQECYDVKAAVHQINFTVGQTSEWIHGIQRKTDEETLTLQKIVTDWQNYTRL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SCARA3 Antibody - BSA Free
Western Blot: SCARA3 Antibody [NBP2-13286]
Western Blot: SCARA3 Antibody [NBP2-13286] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).Immunohistochemistry-Paraffin: SCARA3 Antibody [NBP2-13286]
Immunohistochemistry-Paraffin: SCARA3 Antibody [NBP2-13286] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunohistochemistry: SCARA3 Antibody - BSA Free [NBP2-13286]
Staining of human prostate shows strong cytoplasm granular positivity in smooth muscle cells.Immunohistochemistry: SCARA3 Antibody - BSA Free [NBP2-13286]
Staining of human kidney shows strong cytoplasm granular positivity in cells in tubules.Immunohistochemistry: SCARA3 Antibody - BSA Free [NBP2-13286]
Staining of human fallopian tube shows strong cytoplasm granular positivity.Immunohistochemistry: SCARA3 Antibody - BSA Free [NBP2-13286]
Staining of human small intestine shows strong cytoplasm granular positivity in glandular cells.Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286]
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286] -
SCARA3 inhibits proliferation of lung cancer in vivo. A Western blot analysis for Flag-SCARA3 expression in indicated H1299 cells. B Tumors derived from indicated H1299 cells at end point (n = 5 mice per group). C Average tumor weight of indicated group at the endpoint of the experimenth. D Growth curves of tumors derived from indicated H1299 cells in mice. Data are shown as mean +/- SD. ***, P < 0.001, two-way ANOVA. E Western blot analysis for shSCARA3 expression in indicated A549 cells. F Tumors derived from the indicated A549 cells at end point (n = 5 mice per group). G Average tumor weight of the indicated group at the endpoint of the experiment. H Growth curves of tumors derived from indicated A549 cells in mice. Data are shown as mean +/- SD. ***, P < 0.001, two-way ANOVA. I and J Tumor sections from mice injected with indicated H1299 and A549 cells were stained with hematoxylin-eosin. Immunostained sections were stained with SCARA3 and Ki67. Scale bar = 100 μm Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35578316), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286] -
SCARA3 inhibits proliferation of lung cancer in vivo. A Western blot analysis for Flag-SCARA3 expression in indicated H1299 cells. B Tumors derived from indicated H1299 cells at end point (n = 5 mice per group). C Average tumor weight of indicated group at the endpoint of the experimenth. D Growth curves of tumors derived from indicated H1299 cells in mice. Data are shown as mean +/- SD. ***, P < 0.001, two-way ANOVA. E Western blot analysis for shSCARA3 expression in indicated A549 cells. F Tumors derived from the indicated A549 cells at end point (n = 5 mice per group). G Average tumor weight of the indicated group at the endpoint of the experiment. H Growth curves of tumors derived from indicated A549 cells in mice. Data are shown as mean +/- SD. ***, P < 0.001, two-way ANOVA. I and J Tumor sections from mice injected with indicated H1299 and A549 cells were stained with hematoxylin-eosin. Immunostained sections were stained with SCARA3 and Ki67. Scale bar = 100 μm Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35578316), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286] -
Overexpression of SCARA3 downregulates Epithelial-Mesenchymal Transition (EMT). A Migration of H1299 and A549 cells determined with Transwell assays. B H1299 and A549 invasion ability examined by Matrigel Transwell invasion assay. Quantitative results of migration and invasion assays are shown below. Data are presented as mean +/- SD of three independent experiments. ***, P < 0.001. C Flag-tagged SCARA3 was expressed in H1299 cells. Protein levels of beta -catenin, vimentin, and MMP9 were examined by Western blot using their specific antibodies. D Immunofluorescent staining of fixed H1299 cells with anti-Flag and beta -catenin antibodies. Nuclei were stained with DAPI. Scale bar = 20 μm. E Flag-tagged SCARA3 was expressed in A549 cells. Protein levels of beta -catenin, vimentin, and MMP9 were examined by Western blot using their specific antibodies. F Immunofluorescent staining of fixed A549 cells with anti-Flag and beta -catenin antibodies. Nuclei were stained with DAPI. Scale bar = 20 μm Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35578316), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286] -
SCARA3 is aberrantly downregulated in lung cancer. A Expression of SCARA3 mRNA in 10 primary cancer types from TCGA. Data are shown as mean +/- SD. ns, not significant; ***, P < 0.001, two-tailed Student’s t-test. B SCARA3 gene is located on the short arm of chromosome 8 at position 8q21.1. C Alteration frequency of SCARA3 gene in 10 cancer types from TCGA. D Kaplan-Meier analysis of survival according to SCARA3 in lung cancer, breast cancer, and head and neck cancer patients. P values are from a Log-rank test. E, F SCARA3 protein was immunohistochemically stained with brown color in the cytoplasm and/or nuclei of lung cancer tissues. Scale bar = 100 μm. G, H Expression levels of SCAR3 proteins (G) mRNAs (H) were determined by Western blot and RT- qPCR, respectively, using specific anti-SCARA3 antibodies and SCARA3-specific primers in various lung cancer cell lines and adjacent normal cell lines. Data are presented as mean +/- SD of three independent experiments. **, P < 0.01; ***, P < 0.001 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35578316), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SCARA3 Antibody - BSA Free [NBP2-13286] -
Overexpression of SCARA3 downregulates Epithelial-Mesenchymal Transition (EMT). A Migration of H1299 and A549 cells determined with Transwell assays. B H1299 and A549 invasion ability examined by Matrigel Transwell invasion assay. Quantitative results of migration and invasion assays are shown below. Data are presented as mean +/- SD of three independent experiments. ***, P < 0.001. C Flag-tagged SCARA3 was expressed in H1299 cells. Protein levels of beta -catenin, vimentin, and MMP9 were examined by Western blot using their specific antibodies. D Immunofluorescent staining of fixed H1299 cells with anti-Flag and beta -catenin antibodies. Nuclei were stained with DAPI. Scale bar = 20 μm. E Flag-tagged SCARA3 was expressed in A549 cells. Protein levels of beta -catenin, vimentin, and MMP9 were examined by Western blot using their specific antibodies. F Immunofluorescent staining of fixed A549 cells with anti-Flag and beta -catenin antibodies. Nuclei were stained with DAPI. Scale bar = 20 μm Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35578316), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SCARA3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SCARA3
Long Name
Scavenger Receptor Class A Member 3
Alternate Names
APC7, CSR, MSRL1
Gene Symbol
SCARA3
Additional SCARA3 Products
Product Documents for SCARA3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SCARA3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for SCARA3 Antibody - BSA Free
Customer Reviews for SCARA3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SCARA3 Antibody - BSA Free and earn rewards!
Have you used SCARA3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...