SCYL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88225

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SCYL1. Peptide sequence: FATLSARPSTQPRPDSWGEDNWEGLETDSRQVKAELARKKREERRREMEA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SCYL1 Antibody - BSA Free

Western Blot: SCYL1 Antibody [NBP2-88225]

Western Blot: SCYL1 Antibody [NBP2-88225]

Western Blot: SCYL1 Antibody [NBP2-88225] - WB Suggested Anti-SCYL1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

Applications for SCYL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCYL1

SCYL1 encodes a transcriptional regulator belonging to the SCY1-like family of kinase-like proteins. The protein has a divergent N-terminal kinase domain that is thought to be catalytically inactive, and can bind specific DNA sequences through its C-terminal domain. It activates transcription of the telomerase reverse transcriptase and DNA polymerase beta genes. The protein has been localized to the nucleus, and also to the cytoplasm and centrosomes during mitosis. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

Coated vesicle-associated kinase of 90 kDa, CVAK90, GKLPTelomerase transcriptional element-interacting factor, likely ortholog of mouse N-terminal kinase-like protein, MGC78454, NKTL, N-terminal kinase-like protein, NTKLN-terminal kinase-like, P105, SCY1-like 1 (S. cerevisiae), TAPKTeratoma-associated tyrosine kinase, TEIFSCY1-like protein 1, Telomerase regulation-associated protein, telomerase transcriptional elements-interacting factor, TRAPHT019

Gene Symbol

SCYL1

Additional SCYL1 Products

Product Documents for SCYL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCYL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCYL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCYL1 Antibody - BSA Free and earn rewards!

Have you used SCYL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...