SDHC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86796

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SDHC Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHC. Peptide sequence: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SDHC Antibody - BSA Free

Western Blot: SDHC Antibody [NBP2-86796]

Western Blot: SDHC Antibody [NBP2-86796]

Western Blot: SDHC Antibody [NBP2-86796] - Host: Rabbit. Target Name: SDHC. Sample Type: NCI-H226 Whole cell lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: SDHC Antibody [NBP2-86796]

Immunohistochemistry-Paraffin: SDHC Antibody [NBP2-86796]

Immunohistochemistry-Paraffin: SDHC Antibody [NBP2-86796] - Rabbit Anti-SDHC Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic in mitochondria. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.

Applications for SDHC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SDHC

SDHC encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

Integral membrane protein CII-3, mitochondrial, PGL3, QPs1, QPs-1, SDH3, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa, succinate-ubiquinone oxidoreducatase cytochrome B large subunit

Gene Symbol

SDHC

Additional SDHC Products

Product Documents for SDHC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SDHC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SDHC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SDHC Antibody - BSA Free and earn rewards!

Have you used SDHC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies