SEC14L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88229

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SEC14L1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEC14L1. Peptide sequence: GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SEC14L1 Antibody - BSA Free

Western Blot: SEC14L1 Antibody [NBP2-88229]

Western Blot: SEC14L1 Antibody [NBP2-88229]

Western Blot: SEC14L1 Antibody [NBP2-88229] - WB Suggested Anti-SEC14L1 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

Applications for SEC14L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC14L1

The protein encoded by the SEC14L1 gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene. (provided by RefSeq)

Alternate Names

DKFZp686C06176, PRELID4A, SEC14L, SEC14-like 1 (S. cerevisiae), SEC14-like protein 1

Gene Symbol

SEC14L1

Additional SEC14L1 Products

Product Documents for SEC14L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEC14L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC14L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC14L1 Antibody - BSA Free and earn rewards!

Have you used SEC14L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies