SEC24C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83507

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SEC24C Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SEC24C. Peptide sequence: AVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SEC24C Antibody - BSA Free

Western Blot: SEC24C Antibody [NBP2-83507]

Western Blot: SEC24C Antibody [NBP2-83507]

Western Blot: SEC24C Antibody [NBP2-83507] - Host: Rabbit. Target Name: SEC24C. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SEC24C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC24C

The protein encoded by the SEC24C gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The product of this gene may play a role in shaping the vesicle, as well as in cargo selection and concentration. Alternatively spliced transcript variants encoding the same protein have been identified. (provided by RefSeq)

Alternate Names

KIAA0079SEC24-related protein C, protein transport protein Sec24C, SEC24 (S. cerevisiae) related gene family, member C, SEC24 family, member C (S. cerevisiae), SEC24 related gene family, member C

Gene Symbol

SEC24C

Additional SEC24C Products

Product Documents for SEC24C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEC24C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC24C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC24C Antibody - BSA Free and earn rewards!

Have you used SEC24C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies