SEC24D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55382

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC24D Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQP

Reactivity Notes

Mouse 85%, Rat 84%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SEC24D Antibody - BSA Free (NBP2-55382) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SEC24D Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SEC24D Antibody [NBP2-55382]

Immunocytochemistry/ Immunofluorescence: SEC24D Antibody [NBP2-55382]

Immunocytochemistry/Immunofluorescence: SEC24D Antibody [NBP2-55382] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Applications for SEC24D Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC24D

SEC24D is encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. This gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration.

Alternate Names

FLJ43974, KIAA0755member D, SEC24 family, member D (S. cerevisiae), SEC24 related gene family, member D

Gene Symbol

SEC24D

Additional SEC24D Products

Product Documents for SEC24D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC24D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC24D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC24D Antibody - BSA Free and earn rewards!

Have you used SEC24D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies