SEC31A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79575

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC31A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Sec31aThe immunogen for this antibody is Sec31a. Peptide sequence DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

136 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SEC31A Antibody - BSA Free

Western Blot: SEC31A Antibody [NBP1-79575]

Western Blot: SEC31A Antibody [NBP1-79575]

Western Blot: SEC31A Antibody [NBP1-79575] - Rat Brain lysate, concentration 1 ug/ml.

Applications for SEC31A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC31A

Sec31A is similar to yeast Sec31 protein. Yeast Sec31 protein is known to be a component of the COPII protein complex which is responsible for vesicle budding from endoplasmic reticulum (ER). This protein was found to colocalize with SEC13, one of the other components of COPII, in the subcellular structures corresponding to the vesicle transport function.

Alternate Names

ABP125ABP130KIAA0905Web1-like protein, DKFZp686N07171, HSPC334, MGC90305, protein transport protein Sec31A, protein-transport protein SEC31, SEC31 homolog A (S. cerevisiae), SEC31L1, SEC31-like 1, SEC31-like 1 (S. cerevisiae), SEC31-like protein 1, SEC31-related protein A, yeast Sec31p homolog

Gene Symbol

SEC31A

UniProt

NP_148981 (Rat)

Additional SEC31A Products

Product Documents for SEC31A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC31A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC31A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC31A Antibody - BSA Free and earn rewards!

Have you used SEC31A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies