SEC31B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85707

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SEC31B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SEC31B. Peptide sequence: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SEC31B Antibody - BSA Free

Western Blot: SEC31B Antibody [NBP2-85707]

Western Blot: SEC31B Antibody [NBP2-85707]

Western Blot: SEC31B Antibody [NBP2-85707] - Host: Rabbit. Target Name: SEC31B. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/mlSEC31B is supported by BioGPS gene expression data to be expressed in HepG2

Applications for SEC31B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC31B

SEC31B is a protein of unknown function. It has has moderate similarity to rat VAP1 protein which is an endosomal membrane-associated protein, containing a putative Ca2+/calmodulin-dependent kinase II phosphorylation site.

Alternate Names

DKFZP434M183, protein transport protein Sec31B, SEC31 homolog B (S. cerevisiae), SEC31B-1DKFZp434M183, SEC31L2, SEC31-like 2, SEC31-like 2 (S. cerevisiae), SEC31-like protein 2, SEC31-related protein B, secretory pathway component Sec31B-1

Gene Symbol

SEC31B

Additional SEC31B Products

Product Documents for SEC31B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEC31B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC31B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC31B Antibody - BSA Free and earn rewards!

Have you used SEC31B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies