SEC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55109

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to EXOC3(exocyst complex component 3) The peptide sequence was selected from the middle region of EXOC3. Peptide sequence LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SEC6 Antibody - BSA Free

Western Blot: SEC6 Antibody [NBP1-55109]

Western Blot: SEC6 Antibody [NBP1-55109]

Western Blot: SEC6 Antibody [NBP1-55109] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Immunohistochemistry-Paraffin: SEC6 Antibody [NBP1-55109] -

Immunohistochemistry-Paraffin: SEC6 Antibody [NBP1-55109] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic and membrane in alveolar type I cells; Primary Antibody Concentration: 1:100

Applications for SEC6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC6

EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Alternate Names

exocyst complex component 3, Exocyst complex component Sec6, Sec 6 homolog, SEC6, SEC6L1, SEC6-like 1, SEC6-like 1 (S. cerevisiae), Sec6p

Gene Symbol

EXOC3

UniProt

Additional SEC6 Products

Product Documents for SEC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC6 Antibody - BSA Free and earn rewards!

Have you used SEC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...