Secretory phospholipase A2 Type V Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57906

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Secretory phospholipase A2 Type V Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PLA2G5(phospholipase A2, group V) The peptide sequence was selected from the middle region of PLA2G5. Peptide sequence YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Secretory phospholipase A2 Type V Antibody - BSA Free

Western Blot: Secretory phospholipase A2 Type V Antibody [NBP1-57906]

Western Blot: Secretory phospholipase A2 Type V Antibody [NBP1-57906]

Western Blot: Secretory phospholipase A2 Type V Antibody [NBP1-57906] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Applications for Secretory phospholipase A2 Type V Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Secretory phospholipase A2 Type V

This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip

Alternate Names

Ca2+-dependent phospholipase A2, calcium-dependent phospholipase A2, DKFZp686C2294, EC 3.1.1.4, Group V phospholipase A2, GV-PLA2, hVPLA(2), MGC46205, Phosphatidylcholine 2-acylhydrolase 5, phospholipase A2, group V, PLA2-10

Gene Symbol

PLA2G5

UniProt

P39877 (Human)

Additional Secretory phospholipase A2 Type V Products

Product Documents for Secretory phospholipase A2 Type V Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Secretory phospholipase A2 Type V Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Secretory phospholipase A2 Type V Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Secretory phospholipase A2 Type V Antibody - BSA Free and earn rewards!

Have you used Secretory phospholipase A2 Type V Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies