Seladin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59369

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to DHCR24(24-dehydrocholesterol reductase) The peptide sequence was selected from the N terminal of DHCR24. Peptide sequence FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Seladin 1 Antibody - BSA Free

Western Blot: Seladin 1 Antibody [NBP1-59369]

Western Blot: Seladin 1 Antibody [NBP1-59369]

Western Blot: Seladin 1 Antibody [NBP1-59369] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Seladin 1 Antibody [NBP1-59369]

Western Blot: Seladin 1 Antibody [NBP1-59369]

Western Blot: Seladin 1 Antibody [NBP1-59369] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for Seladin 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Seladin 1

DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

24-dehydrocholesterol reductaseNbla03646, DCE, desmosterol-to-cholesterol enzyme, Diminuto/dwarf1 homolog, EC 1.3.1.72, KIAA0018SELADIN1, seladin 1,3-beta-hydroxysterol delta-24-reductase, seladin-1, selective AD indicator 1,3 beta-hydroxysterol delta 24-reductase

Gene Symbol

DHCR24

UniProt

Additional Seladin 1 Products

Product Documents for Seladin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Seladin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Seladin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Seladin 1 Antibody - BSA Free and earn rewards!

Have you used Seladin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...