SELENBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55263

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SELENBP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the C terminal of SELENBP1 (AAH32997). Peptide sequence KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SELENBP1 Antibody - BSA Free

Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: SELENBP1 Antibody [NBP1-55263]

Immunohistochemistry: SELENBP1 Antibody [NBP1-55263]

Immunohistochemistry: SELENBP1 Antibody [NBP1-55263] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263] - Sample Tissue: Human 721_B Antibody Dilution: 1.0 ug/ml
Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263]

Western Blot: SELENBP1 Antibody [NBP1-55263] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: 721_B cell lysate

Applications for SELENBP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SELENBP1

SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Alternate Names

56 kDa selenium-binding protein, hSBP, hSP56, LPSB, SBP, SBP56, selenium binding protein 1, selenium-binding protein 1, SP56FLJ13813

Entrez Gene IDs

8991 (Human)

Gene Symbol

SELENBP1

UniProt

Q13228 (Human)

Additional SELENBP1 Products

Product Documents for SELENBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SELENBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SELENBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SELENBP1 Antibody - BSA Free and earn rewards!

Have you used SELENBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies