SENP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98428

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SENP6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Senp6 - C-terminal region. Peptide sequence LAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SENP6 Antibody - BSA Free

Western Blot: SENP6 Antibody [NBP1-98428]

Western Blot: SENP6 Antibody [NBP1-98428]

Western Blot: SENP6 Antibody [NBP1-98428] - Mouse Lung lysate, concentration 1.0ug/ml.

Applications for SENP6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SENP6

Senp6 is a protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Senp6 rocesses preferentially poly-SUMO2 and poly-SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Senp6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. Senp6 is involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Senp6 desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation and desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination.

Alternate Names

EC 3.4.22.-, KIAA0797FLJ11887, Sentrin/SUMO-specific protease SENP6, sentrin-specific protease 6, SSP1KIAA0389, SUMO1/sentrin specific peptidase 6,2810017C20Rik, SUMO1/sentrin specific protease 6, SUMO-1-specific protease 1, SUSP1FLJ11355

Gene Symbol

SENP6

UniProt

NP_666115 (Mouse)

Additional SENP6 Products

Product Documents for SENP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SENP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SENP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SENP6 Antibody - BSA Free and earn rewards!

Have you used SENP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies