SENP7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88238

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SENP7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SENP7. Peptide sequence: SLESYQNLNPHKSCYLSERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SENP7 Antibody - BSA Free

Western Blot: SENP7 Antibody [NBP2-88238]

Western Blot: SENP7 Antibody [NBP2-88238]

Western Blot: SENP7 Antibody [NBP2-88238] - Host: Rabbit. Target Name: SENP7. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for SENP7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SENP7

SENP7, SAE1, or SUMO-1 specific protease 2 is a ubiquitin-like (Ubl) protein that has been shown to bind to several protiens including Ran GTPase-activating protein 1 (RanGAP1), IkappaBalpha, and PML. These bindings implicate SUMO in the stabilization of the target proteins and/or their localization to subcellular complexes.

Alternate Names

EC 3.4.22.-, KIAA1707SUMO1/sentrin specific protease 7, MGC157730, Sentrin/SUMO-specific protease SENP7, sentrin-specific protease 7, SSP2, SUMO1/sentrin specific peptidase 7, SUMO-1-specific protease 2, SUSP2

Gene Symbol

SENP7

Additional SENP7 Products

Product Documents for SENP7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SENP7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SENP7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SENP7 Antibody - BSA Free and earn rewards!

Have you used SENP7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies