Sentan Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92378

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sentan Antibody - BSA Free

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human bronchus shows moderate positivity in cilia of respiratory epithelial cells.
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-SNTN antibody NBP1-92378 (A) shows similar protein distribution across tissues to independent antibody NBP2-38853 (B).
Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378]

Immunohistochemistry-Paraffin: Sentan Antibody [NBP1-92378] - Staining of human testis.
Sentan Antibody - BSA Free Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Staining of human prostate shows negative cytoplasmic positivity in glandular cells as expected.
Sentan Antibody - BSA Free Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Staining of human fallopian tube shows strong positivity in cilia in glandular cells.
Sentan Antibody - BSA Free Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Staining of human liver shows negative cytoplasmic positivity in hepatocytes as expected.
Sentan Antibody - BSA Free Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Analysis in human fallopian tube and prostate tissues using NBP1-92378 antibody. Corresponding SNTN RNA-seq data are presented for the same tissues.
Sentan Antibody - BSA Free Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Staining of human skeletal muscle shows negative cytoplasmic positivity in myocytes as expected.
Sentan Antibody - BSA Free Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Immunohistochemistry: Sentan Antibody - BSA Free [NBP1-92378]

Staining of human fallopian tube).

Applications for Sentan Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sentan

Alternate Names

FLJ44379, S100A1L, sentan, sentan, cilia apical structure protein

Gene Symbol

SNTN

Additional Sentan Products

Product Documents for Sentan Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sentan Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sentan Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sentan Antibody - BSA Free and earn rewards!

Have you used Sentan Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...