SEPHS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13293

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEPHS2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SEPHS2 Antibody - BSA Free (NBP2-13293) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SEPHS2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SEPHS2 Antibody [NBP2-13293]

Immunocytochemistry/ Immunofluorescence: SEPHS2 Antibody [NBP2-13293]

Immunocytochemistry/Immunofluorescence: SEPHS2 Antibody [NBP2-13293] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: SEPHS2 Antibody [NBP2-13293]

Immunohistochemistry-Paraffin: SEPHS2 Antibody [NBP2-13293]

Immunohistochemistry-Paraffin: SEPHS2 Antibody [NBP2-13293] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.
SEPHS2 Antibody - BSA Free Immunohistochemistry: SEPHS2 Antibody - BSA Free [NBP2-13293]

Immunohistochemistry: SEPHS2 Antibody - BSA Free [NBP2-13293]

Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Applications for SEPHS2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEPHS2

SEPHS2 encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. This protein itself contains a selenocysteine residue in its predicted active site. The 3' UTR of the gene has a stem-loop secondary structure called a selenocysteine insertion sequence (SECIS) element, which allows UGA to direct the incorporation of selenocysteine rather than signal a translational stop. Alternatively spliced transcripts have been identified, but their biological validity has not been determined.

Alternate Names

EC 2.7.9.3, Selenophosphate synthase 2, selenophosphate synthetase 2, SPS2water dikinase 2

Gene Symbol

SEPHS2

Additional SEPHS2 Products

Product Documents for SEPHS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEPHS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEPHS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEPHS2 Antibody - BSA Free and earn rewards!

Have you used SEPHS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies