Septin-6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03686

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Septin-6 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 350-434 of human Septin-6 (NP_055944.2). VKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Septin-6 Antibody - BSA Free

Western Blot: Septin-6 AntibodyBSA Free [NBP3-03686]

Western Blot: Septin-6 AntibodyBSA Free [NBP3-03686]

Western Blot: Septin-6 Antibody [NBP3-03686] - Western blot analysis of extracts of Rat lung, using Septin 6 antibody (NBP3-03686) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Septin-6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Septin-6

The Septin 6 gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint assoc

Alternate Names

KIAA0128SEP2septin 2, MGC16619, MGC20339, SEPT2, septin 6, septin-6

Gene Symbol

SEPTIN6

Additional Septin-6 Products

Product Documents for Septin-6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Septin-6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Septin-6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Septin-6 Antibody - BSA Free and earn rewards!

Have you used Septin-6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies