SERBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57211

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SERBP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SERBP1(SERPINE1 mRNA binding protein 1) The peptide sequence was selected from the middle region of SERBP1. Peptide sequence SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SERBP1 Antibody - BSA Free

Western Blot: SERBP1 Antibody [NBP1-57211]

Western Blot: SERBP1 Antibody [NBP1-57211]

Western Blot: SERBP1 Antibody [NBP1-57211] - HepG2 cell lysate, concentration 0.125ug/ml.

Applications for SERBP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERBP1

SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Alternate Names

CGI-55, CHD3IP, chromodomain helicase DNA binding protein 3 interacting protein, DKFZP564M2423, HABP4L, PAI-1 mRNA binding protein, PAI1 RNA-binding protein 1, PAI-RBP1DKFZp564M2423, PAIRBP1FLJ90489, plasminogen activator inhibitor 1 RNA binding protein, plasminogen activator inhibitor 1 RNA-binding protein, SERPINE1 mRNA binding protein 1, SERPINE1 mRNA-binding protein 1

Gene Symbol

SERBP1

Additional SERBP1 Products

Product Documents for SERBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SERBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SERBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SERBP1 Antibody - BSA Free and earn rewards!

Have you used SERBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies