SERINC3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13296
![Western Blot: SERINC3 Antibody [NBP2-13296]](https://resources.rndsystems.com/images/products/SERINC3-Antibody-Western-Blot-NBP2-13296-img0008.jpg "Western Blot: SERINC3 Antibody [NBP2-13296]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SERINC3 Antibody - BSA Free
Western Blot: SERINC3 Antibody [NBP2-13296]
Western Blot: SERINC3 Antibody [NBP2-13296] - Analysis in human cell line EFO-21.![Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296]](https://resources.rndsystems.com/images/products/SERINC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13296-img0007.jpg "Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296]")
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296]
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.![Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296]](https://resources.rndsystems.com/images/products/SERINC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13296-img0004.jpg "Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296]")
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296]
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.![SERINC3 Antibody - BSA Free Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]](https://resources.rndsystems.com/images/products/nbp2-13296_rabbit-polyclonal-serinc3-antibody-295202516435818.jpg "Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]")
Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.![SERINC3 Antibody - BSA Free Western Blot: SERINC3 Antibody - BSA Free [NBP2-13296]](https://resources.rndsystems.com/images/products/nbp2-13296_rabbit-polyclonal-serinc3-antibody-305202510114718.jpg "Western Blot: SERINC3 Antibody - BSA Free [NBP2-13296]")
Western Blot: SERINC3 Antibody - BSA Free [NBP2-13296]
Analysis in human cell line EFO-21.![SERINC3 Antibody - BSA Free Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]](https://resources.rndsystems.com/images/products/nbp2-13296_rabbit-polyclonal-serinc3-antibody-3052025755299.jpg "Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]")
Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]
Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.![SERINC3 Antibody - BSA Free Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]](https://resources.rndsystems.com/images/products/nbp2-13296_rabbit-polyclonal-serinc3-antibody-30520259554514.jpg "Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]")
Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]
Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.![SERINC3 Antibody - BSA Free Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]](https://resources.rndsystems.com/images/products/nbp2-13296_rabbit-polyclonal-serinc3-antibody-29520251615558.jpg "Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]")
Immunohistochemistry: SERINC3 Antibody - BSA Free [NBP2-13296]
Staining of human cerebral cortex shows moderate positivity in neuronal cells.Applications for SERINC3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SERINC3
Alternate Names
AIGP1, DIFF33tumor differentially expressed 1, placental transmembrane protein (mouse testicular tumor differentiallyexpressed), SBBI99, serine incorporator 3, TDE, TDE1Tumor differentially expressed protein 1, TMS-1, transmembrane protein SBBI99, tumour differentially expressed 1
Gene Symbol
SERINC3
Additional SERINC3 Products
Product Documents for SERINC3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SERINC3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SERINC3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SERINC3 Antibody - BSA Free and earn rewards!
Have you used SERINC3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...