Serpin A9/Centerin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86802

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Serpin A9/Centerin. Peptide sequence: AATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Serpin A9/Centerin Antibody - BSA Free

Western Blot: Serpin A9/Centerin Antibody [NBP2-86802]

Western Blot: Serpin A9/Centerin Antibody [NBP2-86802]

Western Blot: Serpin A9/Centerin Antibody [NBP2-86802] - Host: Rabbit. Target Name: SERPINA9. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Serpin A9/Centerin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Serpin A9/Centerin

The human serpin superfamily consists of at least 35 members that target not only serine proteases, but also selected cysteine proteases and non-protease proteins. Serpins bind the protease active site resulting in a major conformational rearrangement that traps the enzyme in a covalent acyl-enzyme intermediate. As protease inhibitors, serpins have an array of functions including regulating blood clotting, the complement pathway, extracellular matrix remodeling, and cell motility. They are also involved in activities that extend beyond their ability to inhibit proteases. For instance, they may also regulate blood pressure, angiogenesis, or act as storage/transport proteins.

Long Name

Serpin Peptidase Inhibitor, Clade A, Member 9

Alternate Names

Centerin, GCET1, SERPINA11b

Gene Symbol

SERPINA9

Additional Serpin A9/Centerin Products

Product Documents for Serpin A9/Centerin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Serpin A9/Centerin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Serpin A9/Centerin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Serpin A9/Centerin Antibody - BSA Free and earn rewards!

Have you used Serpin A9/Centerin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...