The human serpin superfamily consists of at least 35 members that target not only serine proteases, but also selected cysteine proteases and non-protease proteins. Serpins bind the protease active site resulting in a major conformational rearrangement that traps the enzyme in a covalent acyl-enzyme intermediate. As protease inhibitors, serpins have an array of functions including regulating blood clotting, the complement pathway, extracellular matrix remodeling, and cell motility. They are also involved in activities that extend beyond their ability to inhibit proteases. For instance, they may also regulate blood pressure, angiogenesis, or act as storage/transport proteins.
Serpin G1/C1 Inhibitor Antibody (0D3W8)
Novus Biologicals | Catalog # NBP3-15721
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 0D3W8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Serpin G1/C1 Inhibitor (P05155). SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Serpin G1/C1 Inhibitor Antibody (0D3W8)
Western Blot: Serpin G1/C1 Inhibitor Antibody (0D3W8) [NBP3-15721]
Western Blot: Serpin G1/C1 Inhibitor Antibody (0D3W8) [NBP3-15721] - Western blot analysis of extracts of various cell lines, using Serpin G1/C1 Inhibitor antibody (NBP3-15721) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Applications for Serpin G1/C1 Inhibitor Antibody (0D3W8)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Serpin G1/C1 Inhibitor
Alternate Names
C1 Inhibitor
Gene Symbol
SERPING1
Additional Serpin G1/C1 Inhibitor Products
Product Documents for Serpin G1/C1 Inhibitor Antibody (0D3W8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Serpin G1/C1 Inhibitor Antibody (0D3W8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Serpin G1/C1 Inhibitor Antibody (0D3W8)
There are currently no reviews for this product. Be the first to review Serpin G1/C1 Inhibitor Antibody (0D3W8) and earn rewards!
Have you used Serpin G1/C1 Inhibitor Antibody (0D3W8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...