Serpin G1/C1 Inhibitor Antibody (0D3W8)

Novus Biologicals | Catalog # NBP3-15721

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0D3W8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Serpin G1/C1 Inhibitor (P05155). SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serpin G1/C1 Inhibitor Antibody (0D3W8)

Western Blot: Serpin G1/C1 Inhibitor Antibody (0D3W8) [NBP3-15721]

Western Blot: Serpin G1/C1 Inhibitor Antibody (0D3W8) [NBP3-15721]

Western Blot: Serpin G1/C1 Inhibitor Antibody (0D3W8) [NBP3-15721] - Western blot analysis of extracts of various cell lines, using Serpin G1/C1 Inhibitor antibody (NBP3-15721) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Serpin G1/C1 Inhibitor Antibody (0D3W8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Serpin G1/C1 Inhibitor

The human serpin superfamily consists of at least 35 members that target not only serine proteases, but also selected cysteine proteases and non-protease proteins. Serpins bind the protease active site resulting in a major conformational rearrangement that traps the enzyme in a covalent acyl-enzyme intermediate. As protease inhibitors, serpins have an array of functions including regulating blood clotting, the complement pathway, extracellular matrix remodeling, and cell motility. They are also involved in activities that extend beyond their ability to inhibit proteases. For instance, they may also regulate blood pressure, angiogenesis, or act as storage/transport proteins.

Alternate Names

C1 Inhibitor

Gene Symbol

SERPING1

Additional Serpin G1/C1 Inhibitor Products

Product Documents for Serpin G1/C1 Inhibitor Antibody (0D3W8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Serpin G1/C1 Inhibitor Antibody (0D3W8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Serpin G1/C1 Inhibitor Antibody (0D3W8)

There are currently no reviews for this product. Be the first to review Serpin G1/C1 Inhibitor Antibody (0D3W8) and earn rewards!

Have you used Serpin G1/C1 Inhibitor Antibody (0D3W8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...