SERPINB12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98386

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SERPINB12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is SERPINB12 - N-terminal. Peptide sequence LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SERPINB12 Antibody - BSA Free

Western Blot: SERPINB12 Antibody [NBP1-98386]

Western Blot: SERPINB12 Antibody [NBP1-98386]

Western Blot: SERPINB12 Antibody [NBP1-98386] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Small Intestine.

Applications for SERPINB12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SERPINB12

Members of the human serpin family regulate a diverse array of serine and cysteine proteinases associated with essential biological processes such as fibrinolysis, coagulation, inflammation, cell mobility, cellular differentiation, and apoptosis. Most serpins are secreted and attain physiologic concentrations in the blood and extracellular fluids. However, a subset of the serpin superfamily, the ov-serpins, also resides intracellularly. A novel member of the human ov-serpin gene family, SERPINB12 is expressed in many tissues, including brain, bone marrow, lymph node, heart, lung, liver, pancreas, testis, ovary, and intestines. SERPINB12 is an inhibitor of trypsin-like serine proteinases and a new functional member of the human ov-serpin family.

Alternate Names

MGC119247, MGC119248, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 12, serpin B12, serpin peptidase inhibitor, clade B (ovalbumin), member 12, YUKOPIN

Gene Symbol

SERPINB12

UniProt

NP_536722 (Human)

Additional SERPINB12 Products

Product Documents for SERPINB12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SERPINB12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SERPINB12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SERPINB12 Antibody - BSA Free and earn rewards!

Have you used SERPINB12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies