SFRS12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56945

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SFRS12 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFRS12(splicing factor, arginine/serine-rich 12) The peptide sequence was selected from the N terminal of SFRS12. Peptide sequence DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SFRS12 Antibody - BSA Free

Western Blot: SFRS12 Antibody [NBP1-56945]

Western Blot: SFRS12 Antibody [NBP1-56945]

Western Blot: SFRS12 Antibody [NBP1-56945] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Applications for SFRS12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS12

SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 AW963850.1 1-78 79-415 AK091758.1 1-337 416-2238 BC067770.1 609-2431 2239-3654 BC112343.1 1800-3215 3655-3660 AK125893.1 3379-3384 3661-4030 AL049309.1 705-1074

Alternate Names

DKFZp564B176, Serine/arginine-rich-splicing regulatory protein 86, SFRS12serine-arginine-rich-splicing regulatory protein 86, Splicing factor, arginine/serine-rich 12MGC133045, splicing regulatory glutamine/lysine-rich protein 1, Splicing regulatory protein 508, SRRp508, SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508, SRRP86

Gene Symbol

SREK1

UniProt

Q8WXA9-2 (Human)

Additional SFRS12 Products

Product Documents for SFRS12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SFRS12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS12 Antibody - BSA Free and earn rewards!

Have you used SFRS12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies