SFRS8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57466

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SFRS8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFRS8(splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, Drosophila)) The peptide sequence was selected from the N terminal of SFRS8. Peptide sequence LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SFRS8 Antibody - BSA Free

Western Blot: SFRS8 Antibody [NBP1-57466]

Western Blot: SFRS8 Antibody [NBP1-57466]

Western Blot: SFRS8 Antibody [NBP1-57466] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for SFRS8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS8

SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.

Alternate Names

Drosophila homolog), Drosophila), SFRS8, Splicing factor, arginine/serine-rich 8, splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot, splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, splicing factor, suppressor of white-apricot homolog, splicing factor, suppressor of white-apricot homolog (Drosophila), Suppressor of white apricot protein homolog, SWAPMGC167082

Gene Symbol

SFSWAP

UniProt

B2RN45 (Human)

Additional SFRS8 Products

Product Documents for SFRS8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SFRS8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS8 Antibody - BSA Free and earn rewards!

Have you used SFRS8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies