SGK3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38447

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SGK3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SGK3 (NP_037389.4).

Sequence:
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SGK3 Antibody - BSA Free

SGK3 Antibody

Western Blot: SGK3 Antibody [NBP3-38447] -

Western Blot: SGK3 Antibody [NBP3-38447] - Western blot analysis of various lysates using SGK3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 10s.

Applications for SGK3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SGK3

SGKL/SGK3, also known as CISK for cytokine-independent survival kinase, is a SGK type protein kinase. The protein contains a lipid-binding phox homology (PX) domain, which is required for targeting SGKL/SGK3 protein to the endosomal compartment. SGKL/SGK3 functions downstream of the phosphoinositide 3-kinase (PI3K) cascade and has been implicated in cell survival. The protein has been shown to be phosphorylated and activated by 3-phosphoinositide-dependent protein kinase 1 (PDK1), and to a lesser extent insulin-like growth factor-1, in vitro. Activated SGKL/SGK3 has been shown to phosphorylate glycogen synthase kinase 3 beta (GSK-3beta) in vitro. SGKL/SGK3 expression has been documented in many human tissues but was found to be most abundant in lung. ESTs have been isolated from human tissue libraries, including normal liver, breast and thyroid and cancerous spleen, ear and pancreas.

Long Name

Serum/Glucocorticoid Regulated Kinase 3

Alternate Names

CISK

Gene Symbol

SGK3

Additional SGK3 Products

Product Documents for SGK3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SGK3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SGK3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SGK3 Antibody - BSA Free and earn rewards!

Have you used SGK3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies