SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

Novus Biologicals | Catalog # H00006524-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3G8

Format

Azide and BSA Free
View all SGLT2/SLC5A2 Primary Antibodies »

Product Specifications

Immunogen

SLC5A2 (NP_003032.1, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01]

Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01]

Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody (M01), clone 3G8.Lane 1: SLC5A2 transfected lysate(72.9 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Detection limit for recombinant GST tagged SLC5A2 is 0.03 ng/ml as a capture antibody.

Applications for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SGLT2/SLC5A2

The SGLT2 gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Long Name

Solute Carrier Family 5 (Sodium/Glucose Cotransporter), Member 2

Alternate Names

SLC5A2

Entrez Gene IDs

6524 (Human)

Gene Symbol

SLC5A2

Additional SGLT2/SLC5A2 Products

Product Documents for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

Customer Reviews for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free and earn rewards!

Have you used SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies