SGPL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82341

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SGPL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SGPL1. Peptide sequence: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SGPL1 Antibody - BSA Free

Western Blot: SGPL1 Antibody [NBP2-82341]

Western Blot: SGPL1 Antibody [NBP2-82341]

Western Blot: SGPL1 Antibody [NBP2-82341] - WB Suggested Anti-SGPL1 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellThere is BioGPS gene expression data showing that SGPL1 is expressed in 721_B

Applications for SGPL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SGPL1

SGPL1 - sphingosine-1-phosphate lyase 1

Long Name

Sphingosine-1-Phosphate Lyase 1

Alternate Names

SP-lyase, SPL

Gene Symbol

SGPL1

Additional SGPL1 Products

Product Documents for SGPL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SGPL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bioactive Lipids and Receptors

Customer Reviews for SGPL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SGPL1 Antibody - BSA Free and earn rewards!

Have you used SGPL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies