SGSM2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-93637
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWY
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SGSM2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: SGSM2 Antibody [NBP1-93637]
Immunocytochemistry/Immunofluorescence: SGSM2 Antibody [NBP1-93637] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.Immunohistochemistry-Paraffin: SGSM2 Antibody [NBP1-93637]
Immunohistochemistry-Paraffin: SGSM2 Antibody [NBP1-93637] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal and glia cells.Immunohistochemistry: SGSM2 Antibody - BSA Free [NBP1-93637] -
SGSM2 expression was detected in human breast tissues and human breast cancer cell lines. (a) SGSM2 mRNA expressions in normal and malignant tissues was determined in 53 BC patients via RT-PCR, and the gel band intensities were quantified with PhotoCaptMw software (version 11.0.). We used normalized SGSM2 expression to classify patients into three groups: T > N, N = T, and N > T (N = normal tissue, and T = tumour tissue); and further, (b) quantitative real-time PCR was used to evaluate SGSM2 mRNA expression profiles in paired human breast tumour (red lines) and normal (green lines) tissues (n = 200). (c) The means of SGSM2 mRNA copy number (per μg of mRNA) were calculated from real-time PCR data. The data were analysed with a paired sample t-test with two-sided P-values. (d) In vitro SGSM2 and SGSM3 protein expression was detected in twelve breast cancer cell lines and one breast epithelial cell line; the mean density of SGSM2 and SGSM3 protein level in each cell line was normalized to beta -actin, and the values were compared to the MCF-10A cell line. The hormone receptor status is displayed at the bottom. (e) The distribution of SGSM2 and SGSM3 proteins were determined in ER+/ HER2 – breast cancer tissue sections; Haematoxylin (violet, for nuclei) and eosin (pink) (H&E) staining is shown in the left panels; anti-SGSM2 and anti-SGSM3 antibody bound to antigen is shown in the middle and right panels (N = normal region, T = tumour region). Top panels: 100x, scale bar: 100 μm; bottom panels: 400x, scale bar: 25 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/30744493), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SGSM2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in reported in scientific literature (PMID: 30744493).
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SGSM2
Alternate Names
KIAA0397, RUN and TBC1 domain containing 1, RUN and TBC1 domain-containing protein 1, RUTBC1, small G protein signaling modulator 2, small G protein signaling modulator 2 protein
Gene Symbol
SGSM2
Additional SGSM2 Products
Product Documents for SGSM2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SGSM2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SGSM2 Antibody - BSA Free
Customer Reviews for SGSM2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SGSM2 Antibody - BSA Free and earn rewards!
Have you used SGSM2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...