SH2D3C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58841

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SH2D3C Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SH2D3C(SH2 domain containing 3C) The peptide sequence was selected from the N terminal of SH2D3C. Peptide sequence AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SH2D3C Antibody - BSA Free

Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate
Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841]

Western Blot: SH2D3C Antibody [NBP1-58841] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for SH2D3C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SH2D3C

SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

Alternate Names

CHAT, Novel SH2-containing protein 3, NSP3FLJ39664, PRO34088, SH2 domain containing 3C, SH2 domain-containing 3C, SH2 domain-containing protein 3C

Gene Symbol

SH2D3C

UniProt

Q8N5H7-2 (Human)

Additional SH2D3C Products

Product Documents for SH2D3C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SH2D3C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SH2D3C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SH2D3C Antibody - BSA Free and earn rewards!

Have you used SH2D3C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies