SHMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35223

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SHMT2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 265-504 of human SHMT2 (NP_005403.2).

Sequence:
PSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SHMT2 Antibody - BSA Free

SHMT2 Antibody

Western Blot: SHMT2 Antibody [NBP3-35223] -

Western Blot: SHMT2 Antibody [NBP3-35223] - Western blot analysis of various lysates using SHMT2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
SHMT2 Antibody

Western Blot: SHMT2 Antibody [NBP3-35223] -

Western Blot: SHMT2 Antibody [NBP3-35223] - Western Blot analysis of lysates from wild type (WT) and SHMT2 knockout (KO) HeLa cells using [KO Validated] SHMT2 Rabbit pAb at 1:400 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 30 s.
SHMT2 Antibody

Western Blot: SHMT2 Antibody [NBP3-35223] -

Western Blot: SHMT2 Antibody [NBP3-35223] - Western Blot analysis of various lysates using [KO Validated] SHMT2 Rabbit pAb at 1:400 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 30 s.

Applications for SHMT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SHMT2

The SHMT2 gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glyci

Long Name

Serine hydroxymethyltransferase, mitochondrial

Alternate Names

EC 2.1.2.1, GLY A+, GLYA, glycine auxotroph A, human complement for hamster, Glycine hydroxymethyltransferase, serine aldolase, serine hydroxymethylase, serine hydroxymethyltransferase 2 (mitochondrial), serine hydroxymethyltransferase, mitochondrial, Serine methylase, SHMT, threonine aldolase

Gene Symbol

SHMT2

Additional SHMT2 Products

Product Documents for SHMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SHMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHMT2 Antibody - BSA Free and earn rewards!

Have you used SHMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies