SHOX Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88271

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SHOX Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SHOX. Peptide sequence: EELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SHOX Antibody - BSA Free

Western Blot: SHOX Antibody [NBP2-88271]

Western Blot: SHOX Antibody [NBP2-88271]

Western Blot: SHOX Antibody [NBP2-88271] - WB Suggested Anti-SHOX Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain

Applications for SHOX Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHOX

SHOX belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq]

Alternate Names

GCFXX-linked, PHOGShort stature homeobox-containing protein, Pseudoautosomal homeobox-containing osteogenic protein, short stature homeobox, short stature homeobox protein, SHOXY

Gene Symbol

SHOX

Additional SHOX Products

Product Documents for SHOX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SHOX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHOX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHOX Antibody - BSA Free and earn rewards!

Have you used SHOX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies