SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52816

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SHP/NR0B2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NR0B2(nuclear receptor subfamily 0, group B, member 2) The peptide sequence was selected from the N terminal of NR0B2. Peptide sequence STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free

Western Blot: SHP/NR0B2/Nuclear Receptor SHP Antibody [NBP1-52816]

Western Blot: SHP/NR0B2/Nuclear Receptor SHP Antibody [NBP1-52816]

Western Blot: SHP/NR0B2/Nuclear Receptor SHP Antibody [NBP1-52816] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHP/NR0B2

NR0B2 is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. It is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function. The protein encoded by this gene is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. The gene product is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Small Heterodimer Partner

Alternate Names

NR0B2

Gene Symbol

NR0B2

UniProt

Q15466 (Human)

Additional SHP/NR0B2 Products

Product Documents for SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free and earn rewards!

Have you used SHP/NR0B2/Nuclear Receptor SHP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies