SIM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88273

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SIM2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SIM2. Peptide sequence: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit SIM2 Antibody - BSA Free (NBP2-88273) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SIM2 Antibody - BSA Free

Western Blot: SIM2 Antibody [NBP2-88273]

Western Blot: SIM2 Antibody [NBP2-88273]

Western Blot: SIM2 Antibody [NBP2-88273] - Host: Rabbit. Target Name: SIM2. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SIM2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIM2

SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on the mapping position, its potential function as transcriptional repressor and similarity to Drosophila sim, it is proposed that SIM2 may contribute to some specific Down syndrome phenotypes

Alternate Names

human transcription factor SIM2, homolog of the Drosophila single-minded geneSIM110BHLHE15, short isoform, single-minded (Drosophila) homolog 2, single-minded homolog 2 (Drosophila), transcription factor SIM2

Gene Symbol

SIM2

Additional SIM2 Products

Product Documents for SIM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIM2 Antibody - BSA Free and earn rewards!

Have you used SIM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies