Sin1/MAPKAP1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-89568PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all Sin1/MAPKAP1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAPKAP1.

Source: E. coli

Amino Acid Sequence: ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89568.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-89568PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Sin1/MAPKAP1

Sin1 is a novel component of the eukaryotic SAPK pathway. Sin1 and the H3 and H4 histones interact genetically, with the C terminus of Sin1 physically associating with components of the SWI-SNF complex. This interaction is blocked by the N-terminal half of the protein in full length Sin1. It has been proposed that Sin1 acts as a regulatable bridge between the SWI-SNF complex and the nucleosome Sin1 is also required for effective transcription via the AP-1 factor Pap1, but does not prevent its nuclear translocation. Sin1 is a novel component of the eukaryotic SAPK pathway.

Long Name

Mitogen-Activated Protein Kinase Associated Protein 1

Alternate Names

JC310, MAPKAP1, MIP1

Gene Symbol

MAPKAP1

Additional Sin1/MAPKAP1 Products

Product Documents for Sin1/MAPKAP1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sin1/MAPKAP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy

Customer Reviews for Sin1/MAPKAP1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Sin1/MAPKAP1 Recombinant Protein Antigen and earn rewards!

Have you used Sin1/MAPKAP1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes

Associated Pathways

mTOR Signaling Pathway mTOR Signaling Pathway Thumbnail