SIRP beta 1/CD172b Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13310

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SIRP beta 1/CD172b Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VSKSYALEISAHQKEHGSDITHEPALAPTAPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SIRP beta 1/CD172b Antibody - BSA Free (NBP2-13310) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SIRP beta 1/CD172b Antibody - BSA Free

Immunohistochemistry-Paraffin: SIRP beta 1/CD172b Antibody [NBP2-13310]

Immunohistochemistry-Paraffin: SIRP beta 1/CD172b Antibody [NBP2-13310]

Immunohistochemistry-Paraffin: SIRPB1 Antibody [NBP2-13310] Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Applications for SIRP beta 1/CD172b Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIRP beta 1/CD172b

The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene.

Long Name

Signal-regulatory Protein beta 1

Alternate Names

CD172b, SIRPB1

Entrez Gene IDs

10326 (Human)

Gene Symbol

SIRPB1

Additional SIRP beta 1/CD172b Products

Product Documents for SIRP beta 1/CD172b Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SIRP beta 1/CD172b Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIRP beta 1/CD172b Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIRP beta 1/CD172b Antibody - BSA Free and earn rewards!

Have you used SIRP beta 1/CD172b Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies