SLC17A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85737

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC17A2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of SLC17A2. Peptide sequence: GFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC17A2 Antibody - BSA Free

Western Blot: SLC17A2 Antibody [NBP2-85737]

Western Blot: SLC17A2 Antibody [NBP2-85737]

Western Blot: SLC17A2 Antibody [NBP2-85737] - WB Suggested Anti-Slc17a2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Kidney

Applications for SLC17A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC17A2

An excitatory neurotransmitter glutamate is stored in synaptic vesicles. Excitatory neurons release glutamate by exocytosis into the synaptic cleft in response to neuronal stimulation. Members of the solute carrier family 17 are classified as vesicular glutamate transporters, which participate in the accumulation of glutamate in synaptic vesicles. SLC17A2/NPT3 is predominantly expressed in the heart and skeletal muscles, and weakly in the brain, placenta, lung, liver, and pancreas at the transcriptional level. In addition, SLC17A2/NPT3 mediates the transport of extracellular phosphates into chondrocytes of the growth-plate cartilages.

Alternate Names

MGC138238, NPT3member 2, solute carrier family 17 (sodium phosphate), member 2

Gene Symbol

SLC17A2

Additional SLC17A2 Products

Product Documents for SLC17A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC17A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC17A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC17A2 Antibody - BSA Free and earn rewards!

Have you used SLC17A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies