Recombinant Human SLC22A12 GST (N-Term) Protein

Name: Recombinant Human SLC22A12 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00116085-Q02
Price: 569 USD
Availability: InStock

Novus Biologicals | Catalog # H00116085-Q02

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all SLC22A12 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 281-349 of Human SLC22A12

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SLC22A12 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00116085-Q02

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: SLC22A12

The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Long Name

Solute carrier family 22 member 12

Alternate Names

OATL4, RST, UNQ6453/PRO34004, URAT1

Gene Symbol

SLC22A12

Additional SLC22A12 Products

Product Documents for Recombinant Human SLC22A12 GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human SLC22A12 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human SLC22A12 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human SLC22A12 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human SLC22A12 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image